PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007417
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 298aa    MW: 32922.6 Da    PI: 7.3561
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58684998PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.7e-3092145155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Lsa007417  92 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 145
                59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05989148IPR017930Myb domain
SuperFamilySSF466892.78E-2089149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-3091150IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2493145IPR006447Myb domain, plants
PfamPF002491.1E-795144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MREDESNWFS KWEEQLPSPE DLMPLTQTLI TPDLAIAFDI RSPHNLHSPS LQHHQQPPPI  60
STPSSQPNSG EFDSPELGGG GAGDEPARTL KRPRLVWTPQ LHKRFVDAVA HLGIKNAVPK  120
TIMQLMSVDG LTRENVASHL QKYRLYLKRM QGLSSGSGNG SGGDPATDHL FASSPVPAHF  180
LHQGRPNSDH YLPYVPVAAL QQQHHHQQMA AAAVVAGHHH PQLQPRYGQI GHFGSPRNGQ  240
FEHPFLNRQS HSHSHSHSQQ PIHRVGTPIH NSVPSSYVDD LESANGRKVL TLFPTGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-2091150463ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036386.11e-127PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB44e-49PCL1_ARATH; Transcription factor LUX
TrEMBLA0A124SFJ41e-170A0A124SFJ4_CYNCS; Uncharacterized protein
STRINGSolyc10g080960.1.11e-120(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-84G2-like family protein